PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof017451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HSF
Protein Properties Length: 173aa    MW: 18710 Da    PI: 11.2397
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17454244PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind37.65.9e-122974247
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkh 47
                  Fl+k+++++e+++++e+isw ++g+sfvv+++ e+a+++Lp +Fk 
     Sof017451 29 FLTKTHQMVEERATDEVISWADQGRSFVVWKPVELARDLLPLHFKX 74
                  9*******************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.6E-132474IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.6E-625120IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467858.3E-112574IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004474.3E-92974IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MEEAVAVAVA AASKSSGGRG GGGRRPAPFL TKTHQMVEER ATDEVISWAD QGRSFVVWKP  60
VELARDLLPL HFKXLATFPP SSGSLTPTGF GRWGPDRWEV LERQLSVEAS KGLLAGIRSP  120
QVNDAEVIQQ VRRQRRGERG VPPPYPSPAA PARAHVWGKK RNLNCGGAPG PTR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11622GGRGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.156250.0bud| crown| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150318.12e-34heat shock factor protein 4
SwissprotQ67TP97e-30HSFB1_ORYSJ; Heat stress transcription factor B-1
TrEMBLB6TNF22e-34B6TNF2_MAIZE; Heat shock factor protein 4
STRINGSb02g026590.12e-33(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.12e-20heat shock transcription factor B4